PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR07G20400.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 316aa    MW: 34190.4 Da    PI: 7.0918
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR07G20400.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding543.9e-171562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l + ++++G g+W+++++  g+ R++k+c++rw +yl
  LPERR07G20400.1 15 RGLWSPEEDEKLMNHIAKYGHGCWSSVPKLAGLERCGKSCRLRWINYL 62
                     788*******************************************97 PP

2Myb_DNA-binding53.74.8e-1768112147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++++eE++l+++++ +lG++ W+ Ia+ ++ gRt++++k++w++y
  LPERR07G20400.1  68 RGAFSQEEEDLIIHLHSMLGNK-WSQIAAQLP-GRTDNEVKNFWNSY 112
                      89********************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.1391062IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.9E-261065IPR009057Homeodomain-like
SuperFamilySSF466894.12E-3013109IPR009057Homeodomain-like
SMARTSM007173.1E-131464IPR001005SANT/Myb domain
PfamPF002491.2E-151562IPR001005SANT/Myb domain
CDDcd001673.94E-121862No hitNo description
PROSITE profilePS5129427.13863117IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-2666117IPR009057Homeodomain-like
SMARTSM007176.4E-1667115IPR001005SANT/Myb domain
PfamPF002495.0E-1668112IPR001005SANT/Myb domain
CDDcd001671.90E-1170113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MAKRPGGGAK KKLRRGLWSP EEDEKLMNHI AKYGHGCWSS VPKLAGLERC GKSCRLRWIN  60
YLRPDLKRGA FSQEEEDLII HLHSMLGNKW SQIAAQLPGR TDNEVKNFWN SYIKKKLRQR  120
GIDPATHKPL SDSPAAGNRT RTPALFSDAE LILSSISAAG QHHMPPPPPP PLLMTAAEES  180
YEMYSSEGSL SGSGSYSQST LTAEFTGGIH HSGGGVPPVM AVIPSVSSSS TLSSMAASGL  240
SPPSNATATT TDHDCLPPWL ELGPTTTGDG NNYGAAMDEL RWSDYVMFDG NYGIQGQCIY  300
GGDSKDTPVH FDGNWC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28131175108B-MYB
1h8a_C1e-281311725128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ4773311e-124KJ477331.1 Indosasa hispida MYB transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645477.11e-120PREDICTED: myb-related protein Hv33
TrEMBLA0A0D9X1X00.0A0A0D9X1X0_9ORYZ; Uncharacterized protein
STRINGBGIOSGA026208-PA1e-121(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30923385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G57560.19e-70myb domain protein 50